PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G053900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 452aa    MW: 50938.4 Da    PI: 5.3239
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G053900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.2e-18135181148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g WT eEd  lv++v+q+G + W+ Ia++++ gR +kqc++rw+++l
  Sevir.9G053900.1.p 135 KGQWTSEEDRELVKLVEQFGLRKWSYIAQMLP-GRVGKQCRERWHNHL 181
                         799*****************************.*************97 PP

2Myb_DNA-binding52.61.1e-16188229245
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         + W+ eEd  l++a+k+ G++ W+ Ia++++ gRt++++k++w+
  Sevir.9G053900.1.p 188 DMWSDEEDMVLIQAHKEVGNK-WAEIAKRLP-GRTENSIKNHWN 229
                         67*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.442130185IPR017930Myb domain
SuperFamilySSF466895.03E-31132228IPR009057Homeodomain-like
SMARTSM007173.0E-14134183IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-28136188IPR009057Homeodomain-like
CDDcd001671.27E-14138181No hitNo description
PfamPF139212.4E-18138195No hitNo description
PROSITE profilePS5129419.8186236IPR017930Myb domain
SMARTSM007171.7E-15186234IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-22189234IPR009057Homeodomain-like
CDDcd001671.40E-13190232No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MDFSCFQTHT GICICLPFDS YMQQNGNYEL DPDDHPFEAT GDYISVGSMV PPATFNDLGH  60
HQYFAEREIK KPIFGHASSI DHRVGFQLPM LTPKSEVSHL IESGLGSYKA YEMSDRFVPR  120
KKTSSYSLKK ANIVKGQWTS EEDRELVKLV EQFGLRKWSY IAQMLPGRVG KQCRERWHNH  180
LRPNIKKDMW SDEEDMVLIQ AHKEVGNKWA EIAKRLPGRT ENSIKNHWNA TKRRQFARRR  240
SRSSSKGPRS STLLQNYIKG LGIGPSKNAA PLAQHTLLPP PSPLAQHTLL PPPSPATPGA  300
KSATINEMLE HSPSDILDPQ GMLISAHEYS RCSETQSCEE LLAPVCYDDF SVVDMCDGLF  360
DTKEDAFQAV YAVDDDIDMN YIFNHLDHTI KVDPEISDME MMWDDDVLGC VEPAGSAEVE  420
TVHVKEEMDL VEMVAATQQN YGEAEKSQIS D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-461332352104MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-461332352104C-Myb DNA-Binding Domain
1msf_C1e-461332352104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432521e-120AC243252.2 Panicum virgatum clone PV_ABa094-H10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004986186.20.0PREDICTED: transcription factor MYB46-like
TrEMBLK4AJH60.0K4AJH6_SETIT; Uncharacterized protein
STRINGSi039046m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-60myb domain protein 98